SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420715 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420715
Domain Number 1 Region: 146-253
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000012
Family cAMP-binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420715   Gene: ENSG00000121577   Transcript: ENST00000468801
Sequence length 360
Comment pep:known chromosome:GRCh37:3:119361323:119379437:-1 gene:ENSG00000121577 transcript:ENST00000468801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANSSRVGQLLLQGSACIRWKQDVEGAVYHLANCLLLLGFMGGSGVYGCFYLFGFLSAG
YLCCVLWGWFSACGLDIVLWSFLLAVVCLLQLAHLVYRLREDTLPEEFDLLYKTLCLPLQ
VPLQTYKEIVHCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLQPSEEGVFQVTLTAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYD
ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADAGPESEKGDEEVCEPAVSPPQAT
PTSLQQTPPCSTPPATTNFPAPPTRARLSRPDSGILEIDDFPSYFHQFGFSGKVAAGRIP
Download sequence
Identical sequences ENSP00000420715 ENSP00000420715 ENSP00000438271 NP_001295262.1.87134 NP_001295262.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]