SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420756 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420756
Domain Number 1 Region: 19-131
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 2.78e-28
Family Inosine monophosphate dehydrogenase (IMPDH) 0.00000346
Further Details:      
 
Domain Number 2 Region: 115-180
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000367
Family CBS-domain pair 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420756   Gene: ENSG00000106348   Transcript: ENST00000469328
Sequence length 190
Comment pep:known chromosome:GRCh37:7:128032331:128045919:-1 gene:ENSG00000106348 transcript:ENST00000469328 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XMADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKI
TLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKFEQGFITDPVV
LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEANV
PGPTGDDAKD
Download sequence
Identical sequences H7C5T1
ENSP00000420756 ENSP00000420756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]