SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000421804 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421804
Domain Number 1 Region: 43-132
Classification Level Classification E-value
Superfamily E set domains 5.4e-32
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00072
Further Details:      
 
Domain Number 2 Region: 1-50
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 3.4e-17
Family DNA-binding protein LAG-1 (CSL) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421804   Gene: ENSG00000168214   Transcript: ENST00000504423
Sequence length 135
Comment pep:novel chromosome:GRCh37:4:26430342:26432473:1 gene:ENSG00000168214 transcript:ENST00000504423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQLNGGGDVAMLELT
GQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGI
IYSTSLTFTYTPEPG
Download sequence
Identical sequences A0A2J8NVW2 A0A2J8RFZ7 H0Y8R3
ENSP00000421804 ENSP00000421804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]