SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000422361 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422361
Domain Number 1 Region: 94-153
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000442
Family cAMP-binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422361   Gene: ENSG00000109756   Transcript: ENST00000514565
Sequence length 154
Comment pep:putative chromosome:GRCh37:4:160203656:160244622:1 gene:ENSG00000109756 transcript:ENST00000514565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEAGDMDLSGLP
ETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANM
TMSVRRELCAVMVFAVVERAGTIVLNDGEELDSW
Download sequence
Identical sequences A0A1D5QQ68 A0A2J8MV32 A0A2J8W086 D6RC78
ENSP00000422361 ENSP00000422361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]