SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000422707 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422707
Domain Number 1 Region: 11-117
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000288
Family cAMP-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422707   Gene: ENSG00000109756   Transcript: ENST00000505478
Sequence length 279
Comment pep:putative chromosome:GRCh37:4:160025330:160235920:1 gene:ENSG00000109756 transcript:ENST00000505478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNSFRQAVMKNPPERTPQDLEIVYSYLHGMEALSNLREHQLRLMCETVRYERHEANEVLY
YPDDIGTCWYILLSGSVFIKESMFLPRSSFGKRSAGSFRRGCECIVLEPSEMIVVDYMDE
NEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPMGKPPLPRGYHTECTKSQLPAD
FTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEAGDMDLSGLPETAVD
SEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDI
Download sequence
Identical sequences A0A2J8MV38 A0A2J8W0B8 H0Y905
ENSP00000422707 ENSP00000422707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]