SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000423287 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423287
Domain Number 1 Region: 121-302
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.35e-64
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000334
Further Details:      
 
Domain Number 2 Region: 297-430
Classification Level Classification E-value
Superfamily E set domains 1.35e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423287   Gene: ENSG00000104856   Transcript: ENST00000505236
Sequence length 576
Comment pep:novel chromosome:GRCh37:19:45504719:45541417:1 gene:ENSG00000104856 transcript:ENST00000505236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTEIIDEYIKE
NGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGP
QPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTAC
LVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKI
QLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSEL
RICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIVFKT
PPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLGELN
SSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPGGPD
LLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPG
PGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT
Download sequence
Identical sequences D6R992
XP_005259184.1.92137 ENSP00000423287 ENSP00000423287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]