SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000423703 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423703
Domain Number 1 Region: 162-319
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 2.75e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 16-164
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.24e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Weak hits

Sequence:  ENSP00000423703
Domain Number - Region: 320-347
Classification Level Classification E-value
Superfamily E set domains 0.00476
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423703   Gene: ENSG00000168214   Transcript: ENST00000504907
Sequence length 382
Comment pep:putative chromosome:GRCh37:4:26364058:26432778:1 gene:ENSG00000168214 transcript:ENST00000504907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVY
LMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSD
KRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLR
SQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSV
TGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCP
KEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQVWREYALCRPRHF
CIPRRLEMGPATSPGSSNFGPK
Download sequence
Identical sequences A0A2I3LJA3 A0A2I3RF34 A0A2K5P131 A0A2K5TVV6 A0A2K5YF46 A0A2K6NDL2 D6R927 G3SFM1
ENSP00000423703 ENSP00000423703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]