SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000423862 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423862
Domain Number 1 Region: 30-155
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.49e-58
Family p53 DNA-binding domain-like 0.000000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423862   Gene: ENSG00000141510   Transcript: ENST00000514944
Sequence length 155
Comment pep:novel chromosome:GRCh37:17:7577535:7590745:-1 gene:ENSG00000141510 transcript:ENST00000514944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLYSPALNKMFCQLAKTCPVQLWVDSTPPP
GTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFR
HSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNR
Download sequence
Identical sequences A0A2J8KPC5 A0A2J8RWE6 E9PFT5
ENSP00000423862 ENSP00000423862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]