SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000423907 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423907
Domain Number 1 Region: 141-298
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 4.32e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 1-143
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.17e-63
Family DNA-binding protein LAG-1 (CSL) 0.0000124
Further Details:      
 
Domain Number 3 Region: 299-411
Classification Level Classification E-value
Superfamily E set domains 1.03e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423907   Gene: ENSG00000168214   Transcript: ENST00000507561
Sequence length 465
Comment pep:known chromosome:GRCh37:4:26323224:26432805:1 gene:ENSG00000168214 transcript:ENST00000507561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQ
ESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGV
FLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQ
QWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLD
ADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDK
AEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMY
RCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCS
AAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS
Download sequence
Identical sequences A0A2J8NVW6 A0A2J8RFW4
XP_018881024.1.27298 ENSP00000423907 ENSP00000423907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]