SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000424540 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424540
Domain Number 1 Region: 98-144,184-448,483-628
Classification Level Classification E-value
Superfamily Clc chloride channel 7.32e-128
Family Clc chloride channel 0.00013
Further Details:      
 
Domain Number 2 Region: 635-793
Classification Level Classification E-value
Superfamily CBS-domain pair 4.93e-30
Family CBS-domain pair 0.000000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424540   Gene: ENSG00000109572   Transcript: ENST00000504131
Sequence length 801
Comment pep:known chromosome:GRCh37:4:170541988:170641514:1 gene:ENSG00000109572 transcript:ENST00000504131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTLQLGESHYVVQAGLQLLGSSNPPALASQVAEITGTHYTMTNGGSINSSTHLLDLLDE
PIPGVGTYDDFHTIDWVREKCKDRERHRRINSKKKESAWEMTKSLYDAWSGWLVVTLTGL
ASGALAGLIDIAADWMTDLKEGICLSALWYNHEQCCWGSNETTFEERDKCPQWKTWAELI
IGQAEGPGSYIMNYIMYIFWALSFAFLAVSLVKVFAPYACGSGIPEIKTILSGFIIRGYL
GKWTLMIKTITLVLAVASGLSLGKEGPLVHVACCCGNIFSYLFPKYSTNEAKKREVLSAA
SAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAAFVLRSINPFGNSRLVLF
YVEYHTPWYLFELFPFILLGVFGGLWGAFFIRANIAWCRRRKSTKFGKYPVLEVIIVAAI
TAVIAFPNPYTRLNTSELIKELFTDCGPLESSSLCDYRNDMNASKIVDDIPDRPAGIGVY
SAIWQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAYYHHDWFI
FKEWCEVGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMAAVMTS
KWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVLTQDNMTV
DDIENMINETSYNGFPVIMSKESQRLVGFALRRDLTIAIESARKKQEGIVGSSRVCFAQH
TPSLPAESPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITK
KDILRHMAQTANQDPASIMFN
Download sequence
Identical sequences ENSP00000424540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]