SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000424601 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424601
Domain Number 1 Region: 123-179
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000017
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.073
Further Details:      
 
Domain Number 2 Region: 38-80
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000746
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424601   Gene: ENSG00000063438   Transcript: ENST00000505113
Sequence length 701
Comment pep:known chromosome:GRCh37:5:304291:434972:1 gene:ENSG00000063438 transcript:ENST00000505113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRTMIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPD
IISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLL
ESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMD
PPQVVFGQPPPLETGDDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFL
TMQFQGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADT
AATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQVPARAPCLCL
RGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTKPLPWTAGKHSEDGARPRL
QPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPSAYSSRTSRPMRDVGEDQV
HPPLCHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKME
KDSGCEGAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQP
HGRATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVK
REPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP
Download sequence
Identical sequences A9YTQ3
NP_001229341.1.87134 NP_001229341.1.92137 ENSP00000424601 gi|334848123|ref|NP_001229341.1| ENSP00000424601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]