SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000424815 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424815
Domain Number 1 Region: 42-175
Classification Level Classification E-value
Superfamily E set domains 1.21e-48
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 1-46
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.0000000000000115
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424815   Gene: ENSG00000109320   Transcript: ENST00000508584
Sequence length 196
Comment pep:putative chromosome:GRCh37:4:103499021:103514725:1 gene:ENSG00000109320 transcript:ENST00000508584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGE
EIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKP
ASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGG
MFGSGGGGGGTGSTGP
Download sequence
Identical sequences A0A2J8MAX4 D6RF93
ENSP00000424815 ENSP00000424815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]