SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000425323 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425323
Domain Number 1 Region: 88-134,174-438,473-618
Classification Level Classification E-value
Superfamily Clc chloride channel 5.36e-128
Family Clc chloride channel 0.00013
Further Details:      
 
Domain Number 2 Region: 616-711
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000000185
Family CBS-domain pair 0.0000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425323   Gene: ENSG00000109572   Transcript: ENST00000507875
Sequence length 725
Comment pep:putative chromosome:GRCh37:4:170581213:170634338:1 gene:ENSG00000109572 transcript:ENST00000507875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASSDPYLPYDGGGDSIPLRELHKRGTHYTMTNGGSINSSTHLLDLLDEPIPGVGTYDD
FHTIDWVREKCKDRERHRRINSKKKESAWEMTKSLYDAWSGWLVVTLTGLASGALAGLID
IAADWMTDLKEGICLSALWYNHEQCCWGSNETTFEERDKCPQWKTWAELIIGQAEGPGSY
IMNYIMYIFWALSFAFLAVSLVKVFAPYACGSGIPEIKTILSGFIIRGYLGKWTLMIKTI
TLVLAVASGLSLGKEGPLVHVACCCGNIFSYLFPKYSTNEAKKREVLSAASAAGVSVAFG
APIGGVLFSLEEVSYYFPLKTLWRSFFAALVAAFVLRSINPFGNSRLVLFYVEYHTPWYL
FELFPFILLGVFGGLWGAFFIRANIAWCRRRKSTKFGKYPVLEVIIVAAITAVIAFPNPY
TRLNTSELIKELFTDCGPLESSSLCDYRNDMNASKIVDDIPDRPAGIGVYSAIWQLCLAL
IFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAYYHHDWFIFKEWCEVGAD
CITPGLYAMVGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGRE
GIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVLTQDNMTVDDIENMINET
SYNGFPVIMSKESQRLVGFALRRDLTIAIESARKKQEGIVGSSRVCFAQHTPSLPAESPR
PLKLR
Download sequence
Identical sequences E9PE15
ENSP00000425323 ENSP00000425323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]