SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000425389 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425389
Domain Number 1 Region: 380-602
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-29
Family Ras GEF 0.0025
Further Details:      
 
Domain Number 2 Region: 258-382
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-18
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 17-118
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000157
Family cAMP-binding domain 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSP00000425389
Domain Number - Region: 752-812
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000698
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425389   Gene: ENSG00000158987   Transcript: ENST00000510071
Sequence length 827
Comment pep:putative chromosome:GRCh37:5:130799308:130970924:-1 gene:ENSG00000158987 transcript:ENST00000510071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPVDPGARQALRKKPPERTPEDLNTIYSYLHGMEILSNLREHQLRLMSARARYERYSG
NQVLFCSETIARCWYILLSGSVLVKGSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVEN
AKDNEDSILQREIPARQSRRRFRKINYKGERQTITDDVEVNSYLSLPADLTKMHLTENPH
PQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI
DRTDPLQGRDLVRECLEKEPADKTDDDIEQLLEFMHQLPAFANMTMSVRRELCSVMIFEV
VEQAGAIILEDGQELDSWYVILNGTVEISHPDGKVENLFMGNSFGITPTLDKQYMHGIVR
TKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIKAT
PERLIMHLIEEHSIVDPTYIEDFLLTYRTFLESPLDVGIKLLEWFKIDSLRDKVTRIVLL
WVNNHFNDFEGDPAMTRFLEEFEKNLEDTKMNGHLRLLNIACAAKAKWRQVVLQKASRES
PLQFSLNGGSEKGFGIFVEGVEPGSKAADSGLKRGDQIMEVNGQNFENITFMKAVEILRN
NTHLALTVKTNIFVFKELLFRTEQEKSGVPHIPKIAEKKSNRHSIQHVPGDIEQTSQEKG
SKKVKANTVSGGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDSIVGTRHCRHSLAIMP
IPGTLSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKVDQQSCYIIISKDTTAKEVVFHA
VHEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGR
Download sequence
Identical sequences gi|256600204|ref|NP_001157862.1| ENSP00000425389 NP_001157862.1.87134 NP_001157862.1.92137 ENSP00000425389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]