SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000426862 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426862
Domain Number 1 Region: 406-597
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.35e-49
Family cAMP-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 159-404
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.28e-39
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSP00000426862
Domain Number - Region: 618-664
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426862   Gene: ENSG00000198515   Transcript: ENST00000514170
Sequence length 690
Comment pep:known chromosome:GRCh37:4:47937994:48018609:-1 gene:ENSG00000198515 transcript:ENST00000514170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENP
HARGSFSYKSLRKGGPSQREQYLPGAIALFNVNNSSNKDQEPEEKKKKKKEKKSKSDDKN
ENKNDPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNW
TMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKY
KSNLQFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRI
SNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYVYSLYWSTLTL
TTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQY
MHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIF
ADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSD
GSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGK
QILMKDGLLDLNIANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLT
KVEKFLKPLIDTEFSSIEGPGAESGPIDST
Download sequence
Identical sequences A0A024R9X3 P29973
ENSP00000351320 ENSP00000389881 ENSP00000426862 ENSP00000443401 NP_000078.2.87134 NP_000078.2.92137 XP_011511925.1.92137 XP_016863201.1.92137 ENSP00000351320 ENSP00000389881 ENSP00000426862 gi|71143141|ref|NP_000078.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]