SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000426910 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426910
Domain Number 1 Region: 95-261,557-775,829-869
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-106
Family Ras GEF 0.00015
Further Details:      
 
Domain Number 2 Region: 242-329
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-20
Family PDZ domain 0.0034
Further Details:      
 
Domain Number 3 Region: 3-99
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000707
Family cAMP-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSP00000426910
Domain Number - Region: 467-546
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000132
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426910   Gene: ENSG00000158987   Transcript: ENST00000512052
Sequence length 1114
Comment pep:putative chromosome:GRCh37:5:130771454:130843850:-1 gene:ENSG00000158987 transcript:ENST00000512052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRRELCSVMIFEVVEQAGAIILEDGQELDSWYVILNGTVEISHPDGKVENLFMGNSFG
ITPTLDKQYMHGIVRTKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHREL
DRSGTRKGHIVIKATPERLIMHLIEEHSIVDPTYIEDFLLTYRTFLESPLDVGIKLLEWF
KIDSLRDKVTRIVLLWVNNHFNDFEGDPAMTRFLEEFEKNLEDTKMNGHLRLLNIACAAK
AKWRQVVLQKASRESPLQFSLNGGSEKGFGIFVEGVEPGSKAADSGLKRGDQIMEVNGQN
FENITFMKAVEILRNNTHLALTVKTNIFVFKELLFRTEQEKSGVPHIPKIAEKKSNRHSI
QHVPGDIEQTSQEKGSKKVKANTVSGGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDS
IVGTRHCRHSLAIMPIPGTLSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKVDQQSCYI
IISKDTTAKEVVFHAVHEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLN
GRYYLKNNMETETLCSDEDAQELVKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYI
DDLFKLNSKTGNTHLKRFEDIVNQETFWVASEILTEANQLKRMKIIKHFIKIALHCRECK
NFNSMFAIISGLNLASVARLRGTWEKLPSKYEKHLQDLQDIFDPSRNMAKYRNILSSQSM
QPPIIPLFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMISKEIRQVVRMTSANMDPAMMFR
QRKKRWRSLGSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSS
LDVETDEEKFQMMSLQWEPAYGTLTKNLSEKRSAKSSEMSPVPMRSAGQTTKAHLHQPHR
VSQVLQVPAVNLHPIRKKGQTKDPALNTSLPQKVLGTTEEISGKKHTEDTISVASSLHSS
PPASPQGSPHKVGSIISDHSSKISGQSCPGIGGAYLQKKILQITRSTAKRTDSTEKATEE
NRDRTSCENTTRKRMTSPFRRLRERMLSRERLVNSQKEDTDHNQATESCEKVKDVGSNIK
DEKGSAIFNSNSQGNSNTLNCFYTRFKSKRRKTL
Download sequence
Identical sequences D6RE77
ENSP00000426910 ENSP00000426910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]