SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000427102 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000427102
Domain Number - Region: 111-149
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0804
Family cAMP-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427102   Gene: ENSG00000158987   Transcript: ENST00000504039
Sequence length 149
Comment pep:novel chromosome:GRCh37:5:130843816:130867940:-1 gene:ENSG00000158987 transcript:ENST00000504039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLVRCYANCLQPWASKLPADLTKMHLTENPHPQVTHVSSSQSGCSIASDSGSSSLSDI
YQATESEVGDVDLTRLPEGPVDSEDDEEEDEEIDRTDPLQGRDLVRECLEKEPADKTDDD
IEQLLEFMHQLPAFANMTMSVRRELCSVM
Download sequence
Identical sequences A0A2J8XDY4 D6RD23
ENSP00000427102 ENSP00000427102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]