SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428846 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428846
Domain Number 1 Region: 96-183
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000201
Family RING finger domain, C3HC4 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428846   Gene: ENSG00000156831   Transcript: ENST00000517315
Sequence length 187
Comment pep:putative chromosome:GRCh37:8:126136386:126379360:1 gene:ENSG00000156831 transcript:ENST00000517315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADF
QNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPV
KNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNK
KRHRHSE
Download sequence
Identical sequences A0A2J8PNS7 E5RFJ1
ENSP00000428846 ENSP00000428846 XP_016868822.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]