SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430729 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430729
Domain Number 1 Region: 5-118
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-33
Family Phosphotyrosine-binding domain (PTB) 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430729   Gene: ENSG00000147443   Transcript: ENST00000518197
Sequence length 151
Comment pep:putative chromosome:GRCh37:8:21767146:21771174:-1 gene:ENSG00000147443 transcript:ENST00000518197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAG
RRCVSGEGNFEFETRQGNEIFLALEEAISAQKNAAPATPQPQPATIPASLPRPDSPYSRP
HDSLPPPSPTTPVPAPRPRGQEGEYAVPFDA
Download sequence
Identical sequences E5RIG9
ENSP00000430729 ENSP00000430729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]