SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000431261 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431261
Domain Number 1 Region: 2-39
Classification Level Classification E-value
Superfamily E set domains 0.0000147
Family Filamin repeat (rod domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431261   Gene: ENSG00000134253   Transcript: ENST00000497970
Sequence length 104
Comment pep:known chromosome:GRCh37:1:117653682:117658234:-1 gene:ENSG00000134253 transcript:ENST00000497970 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XTVWVCIKEQHVQGSPFTVMVRRKHRPHSGVFHCCTFCSSGGQKTARCACGGTMPGGYLG
CGHGHKGHPGHPHWSCCGKFNEKSECTWTGGQSAPRSLLRTVAL
Download sequence
Identical sequences H0YCA7
ENSP00000431261 ENSP00000431261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]