SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000432729 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432729
Domain Number 1 Region: 69-151
Classification Level Classification E-value
Superfamily E set domains 4.2e-24
Family Cytoplasmic domain of inward rectifier potassium channel 0.00049
Further Details:      
 
Domain Number 2 Region: 2-84
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000597
Family Voltage-gated potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432729   Gene: ENSG00000187486   Transcript: ENST00000526912
Sequence length 153
Comment pep:putative chromosome:GRCh37:11:17408917:17410632:-1 gene:ENSG00000187486 transcript:ENST00000526912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAIL
ILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRK
SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
Download sequence
Identical sequences A0A2J8UQC2 E9PPF1
ENSP00000432729 ENSP00000432729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]