SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000433295 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433295
Domain Number 1 Region: 175-372
Classification Level Classification E-value
Superfamily E set domains 5.6e-78
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000376
Further Details:      
 
Domain Number 2 Region: 68-191
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.55e-23
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433295   Gene: ENSG00000120457   Transcript: ENST00000529694
Sequence length 419
Comment pep:known chromosome:GRCh37:11:128761251:128790930:1 gene:ENSG00000120457 transcript:ENST00000529694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINQKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
Download sequence
Identical sequences P48544
NP_000881.3.87134 NP_000881.3.92137 XP_011541111.1.92137 XP_011541112.1.92137 ENSP00000339960 ENSP00000339960 ENSP00000433295 ENSP00000434266 gi|24797141|ref|NP_000881.3| ENSP00000339960 ENSP00000433295 ENSP00000434266 9606.ENSP00000339960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]