SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000434372 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434372
Domain Number 1 Region: 9-187
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.18e-74
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 182-208
Classification Level Classification E-value
Superfamily E set domains 0.00000233
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434372   Gene: ENSG00000173039   Transcript: ENST00000534558
Sequence length 208
Comment pep:novel chromosome:GRCh37:11:65426201:65430370:-1 gene:ENSG00000173039 transcript:ENST00000534558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGP
GTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQA
ISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAP
NTAELKICRVNRNSGSCLGGDEIFLLCD
Download sequence
Identical sequences E9PQS6
ENSP00000434372 ENSP00000434372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]