SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000434653 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434653
Domain Number 1 Region: 172-273
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.5e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000571
Further Details:      
 
Weak hits

Sequence:  ENSP00000434653
Domain Number - Region: 50-87
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000112
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434653   Gene: ENSG00000124440   Transcript: ENST00000472815
Sequence length 450
Comment pep:putative chromosome:GRCh37:19:46801683:46841795:1 gene:ENSG00000124440 transcript:ENST00000472815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAAGAARRPRCCTSWLTRCPSPAASAPTWTRPLSCASPSATCACTASAPQLELIGHSI
FDFIHPCDQEELQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLKAATWKVL
NCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLDM
KFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYRFLAR
SGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETGVVLSLEQTEQHSRRPIQRGAP
SQKDTPNPGDSLDTPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGPILDGASVAA
TPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDPSTPLLNL
NEPLGFHFVTQSGVQWHKHSSPQPRPPGLK
Download sequence
Identical sequences H0YDZ5
ENSP00000434653 NP_690009.1.87134 NP_690009.1.92137 gi|23065541|ref|NP_690009.1| ENSP00000434653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]