SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000434755 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434755
Domain Number 1 Region: 69-265
Classification Level Classification E-value
Superfamily E set domains 1.21e-71
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000266
Further Details:      
 
Domain Number 2 Region: 2-84
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000267
Family Voltage-gated potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434755   Gene: ENSG00000187486   Transcript: ENST00000528731
Sequence length 303
Comment pep:putative chromosome:GRCh37:11:17407406:17410878:-1 gene:ENSG00000187486 transcript:ENST00000528731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAIL
ILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRK
SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPL
YDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYS
VDYSKFGNTVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPD
SLS
Download sequence
Identical sequences NP_001159762.1.87134 NP_001159762.1.92137 XP_006718289.1.92137 XP_016873169.1.92137 gi|261399884|ref|NP_001159762.1| ENSP00000434755 ENSP00000434755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]