SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434877 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434877
Domain Number 1 Region: 43-129
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-30
Family G proteins 0.00000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434877   Gene: ENSG00000155366   Transcript: ENST00000484054
Sequence length 129
Comment pep:putative chromosome:GRCh37:1:113245621:113249738:-1 gene:ENSG00000155366 transcript:ENST00000484054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSISGGDLPTGLDFISAPEPALSSCSLGTSAGWSPTMAAIRKKLVIVGDGACGKTCLLI
VFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMC
FSIDSPDSL
Download sequence
Identical sequences E9PN11
ENSP00000434877 ENSP00000434877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]