SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000435200 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435200
Domain Number 1 Region: 85-137
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000576
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435200   Gene: ENSG00000124440   Transcript: ENST00000533145
Sequence length 148
Comment pep:novel chromosome:GRCh37:19:46801679:46811940:1 gene:ENSG00000124440 transcript:ENST00000533145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAAGAARRPRCCTSWLTRCPSPAASAPTWTRPLSCASPSATCACTASAPQATRMYPHF
LGGAWEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQLELIGHS
IFDFIHPCDQEELQDALTPQQTLSRRKV
Download sequence
Identical sequences E9PLC8
ENSP00000435200 ENSP00000435200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]