SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000435290 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435290
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.86e-74
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 191-221
Classification Level Classification E-value
Superfamily E set domains 0.00000000166
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435290   Gene: ENSG00000173039   Transcript: ENST00000526283
Sequence length 237
Comment pep:known chromosome:GRCh37:11:65421073:65430366:-1 gene:ENSG00000173039 transcript:ENST00000526283 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKAHGIPVPARYRRSSPD
Download sequence
Identical sequences E9PKV4
ENSP00000435290 ENSP00000435290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]