SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000435996 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000435996
Domain Number - Region: 6-56
Classification Level Classification E-value
Superfamily E set domains 0.000497
Family Arrestin/Vps26-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435996   Gene: ENSG00000197070   Transcript: ENST00000461627
Sequence length 123
Comment pep:known chromosome:GRCh37:9:140500148:140508193:1 gene:ENSG00000197070 transcript:ENST00000461627 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAW
VVEEGYFNSSLSLADKGKFGSQFPSGDPWGQPLEWGLSVLSSPFPRSASWIWHWPILSQG
CGP
Download sequence
Identical sequences F2Z3I4
ENSP00000435996 ENSP00000435996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]