SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000436313 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436313
Domain Number 1 Region: 29-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.28e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSP00000436313
Domain Number - Region: 107-140
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0324
Family BphP N-terminal domain-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436313   Gene: ENSG00000133794   Transcript: ENST00000530357
Sequence length 141
Comment pep:known chromosome:GRCh37:11:13299362:13387139:1 gene:ENSG00000133794 transcript:ENST00000530357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCN
AMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVG
CDRGKILFVSESVFKILNYSQ
Download sequence
Identical sequences A0A2J8P5C9 A0A2J8UQ39 E9PPV4
ENSP00000436313 ENSP00000436313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]