SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000436530 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436530
Domain Number 1 Region: 2-183
Classification Level Classification E-value
Superfamily E set domains 1.63e-68
Family Arrestin/Vps26-like 0.0000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436530   Gene: ENSG00000137486   Transcript: ENST00000532447
Sequence length 195
Comment pep:putative chromosome:GRCh37:11:74977160:74989743:-1 gene:ENSG00000137486 transcript:ENST00000532447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISV
RQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKH
EDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKEEPPHR
EVMTTLYLRTLLARD
Download sequence
Identical sequences H0YET9
ENSP00000436530 ENSP00000436530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]