SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000436545 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436545
Domain Number 1 Region: 1-165
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.83e-66
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000252
Further Details:      
 
Domain Number 2 Region: 160-185
Classification Level Classification E-value
Superfamily E set domains 0.0000101
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436545   Gene: ENSG00000173039   Transcript: ENST00000527749
Sequence length 185
Comment pep:putative chromosome:GRCh37:11:65426203:65430263:-1 gene:ENSG00000173039 transcript:ENST00000527749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELV
GKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGD
YDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDE
IFLLC
Download sequence
Identical sequences E9PI38
ENSP00000436545 ENSP00000436545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]