SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000437454 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437454
Domain Number 1 Region: 11-112
Classification Level Classification E-value
Superfamily E set domains 3.5e-32
Family RhoGDI-like 0.0000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437454   Gene: ENSG00000111348   Transcript: ENST00000541380
Sequence length 112
Comment pep:known chromosome:GRCh37:12:15100811:15114200:-1 gene:ENSG00000111348 transcript:ENST00000541380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVT
DPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIH
Download sequence
Identical sequences A0A2J8QQ45 A0A2J8SQQ4 F5H6Q0
ENSP00000437454 ENSP00000437454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]