SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000437479 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437479
Domain Number 1 Region: 86-402
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.74e-127
Family Transglutaminase core 0.00000000000774
Further Details:      
 
Domain Number 2 Region: 410-525
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.92e-33
Family Transglutaminase, two C-terminal domains 0.000000454
Further Details:      
 
Domain Number 3 Region: 526-626
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.68e-29
Family Transglutaminase, two C-terminal domains 0.00000141
Further Details:      
 
Domain Number 4 Region: 4-84
Classification Level Classification E-value
Superfamily E set domains 1.5e-20
Family Transglutaminase N-terminal domain 0.00000827
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437479   Gene: ENSG00000198959   Transcript: ENST00000536724
Sequence length 627
Comment pep:known chromosome:GRCh37:20:36758536:36793672:-1 gene:ENSG00000198959 transcript:ENST00000536724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA
Download sequence
Identical sequences NP_001310247.1.87134 NP_001310247.1.92137 ENSP00000437479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]