SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000440135 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440135
Domain Number 1 Region: 286-482,583-839
Classification Level Classification E-value
Superfamily Ras GEF 3.27e-116
Family Ras GEF 0.00015
Further Details:      
 
Domain Number 2 Region: 29-167
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-43
Family DEP domain 0.000000169
Further Details:      
 
Domain Number 3 Region: 490-592
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.38e-36
Family Ras-binding domain, RBD 0.0012
Further Details:      
 
Domain Number 4 Region: 160-289
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-25
Family cAMP-binding domain 0.000000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440135   Gene: ENSG00000091428   Transcript: ENST00000538974
Sequence length 840
Comment pep:known chromosome:GRCh37:2:173724771:173916630:1 gene:ENSG00000091428 transcript:ENST00000538974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLLAPPYGVMETGSNNDRIPDKENVPSEKILRAGKILRNAILSRAPHMIRDRKYHLKT
YRQCCVGTELVDWMMQQTPCVHSRTQAVGMWQVLLEDGVLNHVDQEHHFQDKYLFYRFLD
DEHEDAPLPTEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEEL
LHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGV
VCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHD
QDVLVLEKVPAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLN
DFIMMHCVFMPNTQLCPALVAHYHAQPSQGTEQEKMDYALNNKRRVIRLVLQWAAMYGDL
LQEDDVSMAFLEEFYVSVSDDARMIAALKEQLPELEKIVKQISEDAKAPQKKHKVLLQQF
NTGDERAQKRQPIRGSDEVLFKVYCMDHTYTTIRVPVATSVKEVISAVADKLGSGEGLII
VKMSSGGEKVVLKPNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTVGTVGTFELM
SSKDLAYQMTIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEI
CLCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKK
FYAEFESLMDPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKM
RMIANTARTVRYYRSQPFNPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
Download sequence
Identical sequences A0A2J8PQZ6
ENSP00000440135 NP_001269829.1.87134 NP_001269829.1.92137 XP_003824301.1.60992 XP_006712268.1.92137 ENSP00000440135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]