SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000440308 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000440308
Domain Number - Region: 5-67
Classification Level Classification E-value
Superfamily E set domains 0.0273
Family Arrestin/Vps26-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440308   Gene: ENSG00000157538   Transcript: ENST00000539844
Sequence length 220
Comment pep:known chromosome:GRCh37:21:38597556:38639623:-1 gene:ENSG00000157538 transcript:ENST00000539844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTALDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFE
AFYNSVKPQKGKFTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGEL
VVESSEAAIRSVELQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRL
FTCPTLETTNFKVEFEVNIVVLLHPDHLITENFPLKLCRI
Download sequence
Identical sequences B7Z606
ENSP00000440308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]