SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000441091 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441091
Domain Number 1 Region: 406-664
Classification Level Classification E-value
Superfamily NHL repeat 2.88e-47
Family NHL repeat 0.00000872
Further Details:      
 
Domain Number 2 Region: 244-340
Classification Level Classification E-value
Superfamily E set domains 7.34e-25
Family Filamin repeat (rod domain) 0.0015
Further Details:      
 
Domain Number 3 Region: 16-91
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000166
Family RING finger domain, C3HC4 0.0059
Further Details:      
 
Domain Number 4 Region: 105-169
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000473
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000441091   Gene: ENSG00000110171   Transcript: ENST00000537602
Sequence length 666
Comment pep:known chromosome:GRCh37:11:6469847:6495214:-1 gene:ENSG00000110171 transcript:ENST00000537602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCP
VCRQTSILPEQGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSVVAGRPLSCPNHEG
KTMEFYCEACETAMCGECRAGEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAAI
ALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLVDGLRRSVLNLGALLTT
SATAHETVATGEGLRQALVGQPASLTVTTKDKDGRLVRTGSAELRAEITGPDGTRLPVPV
VDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRALRPGDLPPSPDDVKRRVKSP
GGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRGREKGEFTNLQGVSAASSG
RIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVAVDTNGDIIVADYDNRWVS
IFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVFTFQPNGKLVGRFGGRGAT
DRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFGSHGEGNGQFNAPTGVAVD
SNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEPLYGPQGLALTSDGHVVVADAGNHCFK
AYRYLQ
Download sequence
Identical sequences ENSP00000441091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]