SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000442488 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442488
Domain Number 1 Region: 21-123
Classification Level Classification E-value
Superfamily E set domains 3.73e-32
Family ML domain 0.00000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442488   Gene: ENSG00000119655   Transcript: ENST00000541064
Sequence length 125
Comment pep:novel chromosome:GRCh37:14:74945926:74959984:-1 gene:ENSG00000119655 transcript:ENST00000541064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVT
FTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYP
SVSHL
Download sequence
Identical sequences A0A1D5QGW3 A0A2I2YXU1 A0A2I3NIC4 A0A2I3RA10 A0A2K5IZM7 A0A2K5M738 A0A2K5VAA1 A0A2K6AFM5 A0A2K6DD27
ENSP00000442488 ENSP00000442488 XP_004091929.1.23891 XP_011804960.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]