SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000442490 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442490
Domain Number 1 Region: 87-144
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000689
Family RING finger domain, C3HC4 0.0027
Further Details:      
 
Domain Number 2 Region: 3-55
Classification Level Classification E-value
Superfamily UBC-like 0.0000549
Family RWD domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442490   Gene: ENSG00000013561   Transcript: ENST00000540015
Sequence length 171
Comment pep:known chromosome:GRCh37:5:141348656:141367773:1 gene:ENSG00000013561 transcript:ENST00000540015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSEKLMDLRNE
YLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCT
GCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED
Download sequence
Identical sequences B7Z3J5
ENSP00000442490 XP_016865566.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]