SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000442736 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442736
Domain Number 1 Region: 69-494
Classification Level Classification E-value
Superfamily Sema domain 3.14e-100
Family Sema domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1392-1518,1713-1864
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-40
Family p120GAP domain-like 0.045
Further Details:      
 
Domain Number 3 Region: 947-1036
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000292
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 4 Region: 855-950
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000759
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 497-549
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000118
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1035-1079,1117-1170
Classification Level Classification E-value
Superfamily E set domains 0.000000229
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.06
Further Details:      
 
Domain Number 7 Region: 1184-1265
Classification Level Classification E-value
Superfamily E set domains 0.0000451
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 
Weak hits

Sequence:  ENSP00000442736
Domain Number - Region: 652-683
Classification Level Classification E-value
Superfamily Plexin repeat 0.034
Family Plexin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442736   Gene: ENSG00000198753   Transcript: ENST00000538966
Sequence length 1932
Comment pep:known chromosome:GRCh37:X:153029651:153044801:1 gene:ENSG00000198753 transcript:ENST00000538966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELTPASSLTCSLLSPRLPGSFPQLRRVPPCSRPWLPKAPVMARWPPFGLCLLLLLLSPP
PLPLTGAHRFSAPNTTLNHLALAPGRGTLYVGAVNRLFQLSPELQLEAVAVTGPVIDSPD
CVPFRDPAECPQAQLTDNANQLLLVSSRAQELVACGQVRQGVCETRRLGDVAEVLYQAED
PGDGQFVAANTPGVATVGLVVPLPGRDLLLVARGLAGKLSAGVPPLAIRQLAGSQPFSSE
GLGRLVVGDFSDYNNSYVGAFADARSAYFVFRRRGARAQAEYRSYVARVCLGDTNLYSYV
EVPLACQGQGLIQAAFLAPGTLLGVFAAGPRGTQAALCAFPMVELGASMEQARRLCYTAG
GRGPSGAEEATVEYGVTSRCVTLPLDSPESYPCGDEHTPSPIAGRQPLEVQPLLKLGQPV
SAVAALQADGHMIAFLGDTQGQLYKVFLHGSQGQVYHSQQVGPPGSAISPDLLLDSSGSH
LYVLTAHQVDRIPVAACPQFPDCASCLQAQDPLCGWCVLQGRCTRKGQCGRAGQLNQWLW
SYEEDSHCLHIQSLLPGHHPRQEQGQVTLSVPRLPILDADEYFHCAFGDYDSLAHVEGPH
VACVTPPQDQVPLNPPGTDHVTVPLALMFEDVTVAATNFSFYDCSAVQALEAAAPCRACV
GSIWRCHWCPQSSHCVYGEHCPEGERTIYSAQEVDIQVRGPGACPQVEGLAGPHLVPVGW
ESHLALRVRNLQHFRGLPASFHCWLELPGELRGLPATLEETAGDSGLIHCQAHQFYPSMS
QRELPVPIYVTQGEAQRLDNTHALYVILYDCAMGHPDCSHCQAANRSLGCLWCADGQPAC
RYGPLCPPGAVELLCPAPSIDAVEPLTGPPEGGLALTILGSNLGRAFADVQYAVSVASRP
CNPEPSLYRTSARIVCVTSPAPNGTTGPVRVAIKSQPPGISSQHFTYQDPVLLSLSPRWG
PQAGGTQLTIRGQHLQTGGNTSAFVGGQPCPILEPVCPEAIVCRTRPQAAPGEAAVLVVF
GHAQRTLLASPFRYTANPQLVAAEPSASFRGGGRLIRVRGTGLDVVQRPLLSVWLEADAE
VQASRAQPQDPQPRRSCGAPAADPQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRA
HPQRVFFTLDNVQVDFASASGGQGFLYQPNPRLAPLSREGPARPYRLKPGHVLDVEGEGL
NLGISKEEVRVHIGRGECLVKTLTRTHLYCEPPAHAPQPANGSGLPQFVVQMGNVQLALG
PVQYEAEPPLSAFPVEAQAGVGMGAAVLIAAVLLLTLMYRHKSKQALRDYQKVLVQLESL
ETGVGDQCRKEFTDLMTEMTDLSSDLEGSGIPFLDYRTYAERAFFPGHGGCPLQPKPEGP
GEDGHCATVRQGLTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVASLLSLALHGKLE
YLTDIMRTLLGDLAAHYVHRNPKLMLRRTETMVEKLLTNWLSICLYAFLREVAGEPLYML
FRAIQYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFQPLTLMVLVGPGAGGAAGSSEMQR
VPARVLDTDTITQVKEKVLDQVYKGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVT
QNHWKRLNTLQHYKVPDGATVGLVPQLHRGSTISQSLAQRCPLGENIPTLEDGEEGGVCL
WHLVKATEEPEGAKVRCSSLREREPARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSV
NRPIPIAVKYLFDLLDELAEKHGIEDPGTLHIWKTNSLLLRFWVNALKNPQLIFDVRVSD
NVDAILAVIAQTFIDSCTTSEHKVGRDSPVNKLLYAREIPRYKQMVERYYADIRQSSPAS
YQEMNSALAELSGNYTSAPHCLEALQELYNHIHRYYDQIISALEEDPVGQKLQLACRLQQ
VAALVENKVTDL
Download sequence
Identical sequences gi|253795481|ref|NP_001156729.1| NP_001156729.1.87134 NP_001156729.1.92137 ENSP00000442736 ENSP00000472712 ENSP00000442736 ENSP00000445569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]