SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000442984 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442984
Domain Number 1 Region: 96-180
Classification Level Classification E-value
Superfamily E set domains 0.000000000934
Family Filamin repeat (rod domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442984   Gene: ENSG00000095110   Transcript: ENST00000536312
Sequence length 295
Comment pep:putative chromosome:GRCh37:11:114397234:114425092:-1 gene:ENSG00000095110 transcript:ENST00000536312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNTMLQKTLLILISFSVVTWMIFIISQNFTKLWSALNLSISVHYWNNSAKSLFPKTSL
IPLKPLTETELRIKEIIEKLDQQIPPRPFTHVNTTTSATHSTATILNPRDTYCRGDQLDI
LLEVRDHLGQRKQYGGDFLRARMSSPALTAGASGKVMDFNNGTYLVSFTLFWEGQVSLSL
LLIHPSEGASALWRARNQGYDKIIFKGKFVNGTSHVFTECGLTLNSNAELCEYLDDRDQE
AFYCMKPQHMPCEALTYMTTRNREVSYLTDKENSLFHRMAPGETSIAGNQVQSGS
Download sequence
Identical sequences F5H6W7
ENSP00000442984 ENSP00000442984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]