SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000443174 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443174
Domain Number 1 Region: 505-803
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.65e-89
Family Complement components 0.0000197
Further Details:      
 
Domain Number 2 Region: 875-1003
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.03e-36
Family Alpha-macroglobulin receptor domain 0.0000522
Further Details:      
 
Domain Number 3 Region: 334-454
Classification Level Classification E-value
Superfamily E set domains 1.34e-32
Family SVA-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443174   Gene: ENSG00000166535   Transcript: ENST00000541459
Sequence length 1004
Comment pep:known chromosome:GRCh37:12:8995832:9028410:1 gene:ENSG00000166535 transcript:ENST00000541459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFLGIHRLNGPLKCGQPQEVLVDYYIDPADASPDQEISFSYYLIGKGSLVMEGQKHLNSK
KKGLKASFSLSLTFTSRLAPDPSLVIYAIFPSGGVVADKIQFSVEMCFDNQVSLGFSPSQ
QLPGAEVELQLQAAPGSLCALRAVDESVLLLRPDRELSNRSVYGMFPFWYGHYPYQVAEY
DQCPVSGPWDFPQPLIDPMPQGHSSQRSIIWRPSFSEGTDLFSFFRDVGLKILSNAKIKK
PVDCSHRSPEYSTAMGAGGGHPEAFESSTPLHQAEDSQVRQYFPETWLWDLFPIGNSGKE
AVHVTVPDAITEWKAMSFCTSQSRGFGLSPTVGLTAFKPFFVDLTLPYSVVRGESFRLTA
TIFNYLKDCIRVQTDLAKSHEYQLESWADSQTSSCLCADDAKTHHWNITAVKLGHINFTI
STKILDSNEPCGGQKGFVPQKGRSDTLIKPVLVKPEGVLVEKTHSSLLCPKGKVASESVS
LELPVDIVPDSTKAYVTVLGDIMGTALQNLDGLVQMPSGCGEQNMVLFAPIIYVLQYLEK
AGLLTEEIRSRAVGFLEIGYQKELMYKHSNGSYSAFGERDGNGNTWLTAFVTKCFGQAQK
FIFIDPKNIQDALKWMAGNQLPSGCYANVGNLLHTAMKGGVDDEVSLTAYVTAALLEMGK
DVDDPMVSQGLRCLKNSATSTTNLYTQALLAYIFSLAGEMDIRNILLKQLDQQAIISGES
IYWSQKPTPSSNASPWSEPAAVDVELTAYALLAQLTKPSLTQKEIAKATSIVAWLAKQHN
AYGGFSSTQDTVVALQALAKYATTAYMPSEEINLVVKSTENFQRTFNIQSVNRLVFQQDT
LPNVPGMYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLT
IHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIK
NTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE
Download sequence
Identical sequences H0YGG5
ENSP00000443174 ENSP00000443174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]