SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000443302 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443302
Domain Number 1 Region: 34-152
Classification Level Classification E-value
Superfamily E set domains 3.08e-35
Family SVA-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443302   Gene: ENSG00000175899   Transcript: ENST00000543436
Sequence length 200
Comment pep:putative chromosome:GRCh37:12:9220260:9244008:-1 gene:ENSG00000175899 transcript:ENST00000543436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKA
TVLNYLPKCIRVSVQLEASPAFLAVPVEKEQAPHCICANGRQTVSWAVTPKSLGNVNFTV
SAEALESQELCGTEVPSVPEHGRKDTVIKPLLKSALLESCSQSSTEDTCFCIFKDLMNKH
FFWSMSFPVSCSFNKYHCTF
Download sequence
Identical sequences ENSP00000443302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]