SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000444536 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444536
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily CBS-domain pair 1.15e-40
Family CBS-domain pair 0.000000386
Further Details:      
 
Domain Number 2 Region: 159-297
Classification Level Classification E-value
Superfamily CBS-domain pair 2.77e-31
Family CBS-domain pair 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444536   Gene: ENSG00000115592   Transcript: ENST00000545803
Sequence length 305
Comment pep:known chromosome:GRCh37:2:219687587:219696524:-1 gene:ENSG00000115592 transcript:ENST00000545803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGMLTIT
DFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYTLIKNR
IHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQDLGIGTFRDLAVVLE
TAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALRQR
TLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLSPAGI
DALGA
Download sequence
Identical sequences B4DT70
ENSP00000444536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]