SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000444699 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444699
Domain Number 1 Region: 67-375
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.7e-85
Family Transglutaminase core 0.000000738
Further Details:      
 
Domain Number 2 Region: 509-607
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.49e-28
Family Transglutaminase, two C-terminal domains 0.00083
Further Details:      
 
Domain Number 3 Region: 395-507
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.02e-28
Family Transglutaminase, two C-terminal domains 0.0026
Further Details:      
 
Domain Number 4 Region: 3-65
Classification Level Classification E-value
Superfamily E set domains 0.00000000000063
Family Transglutaminase N-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444699   Gene: ENSG00000166947   Transcript: ENST00000540029
Sequence length 613
Comment pep:novel chromosome:GRCh37:15:43489428:43513207:-1 gene:ENSG00000166947 transcript:ENST00000540029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVRAFLPALKKVA
LTAQTEDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWDFGQFEGDVIDLSLRLLSK
DKQVEKWSQPVHVARVLGALLHFLKEQRVLPTPQTQATQEGALLNKRRGSVPILRQWLTG
RGRPVYDGQAWVLAAVACTVLRCLGIPARVVTTFASAQGTGGRLLIDEYYNEEGLQNGEG
QRGRIWIFQTSTECWMTRPALPQGYDGWQILHPSAPNGGGVLGSCDLVPVRAVKEGTLGL
TPAVSDLFAAINASCVVWKCCEDGTLELTDSNTKYVGNNISTKGVGSDRCEDITQNYKYP
EGSLQEKEVLERVEKEKMEREKDNGIRPPSLETASPLYLLLKAPSSLPLRGDAQISVTLV
NHSEQEKAVQLAIGVQAVHYNGVLAAKLWRKKLHLTLSANLEKIITIGLFFSNFERNPPE
NTFLRLTAMATHSESNLSCFAQEDIAICRPHLAIKMPEKAEQYQPLTASVSLQNSLDAPM
EDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTN
YKSVTVVAPELSA
Download sequence
Identical sequences F5H563
ENSP00000444699 ENSP00000444699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]