SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000444701 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000444701
Domain Number 1 Region: 65-381
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.25e-127
Family Transglutaminase core 0.00000000000774
Further Details:      
 
Domain Number 2 Region: 389-504
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.92e-33
Family Transglutaminase, two C-terminal domains 0.000000454
Further Details:      
 
Domain Number 3 Region: 505-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.16e-29
Family Transglutaminase, two C-terminal domains 0.00000141
Further Details:      
 
Domain Number 4 Region: 3-64
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000245
Family Transglutaminase N-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000444701   Gene: ENSG00000198959   Transcript: ENST00000536701
Sequence length 606
Comment pep:known chromosome:GRCh37:20:36758357:36793672:-1 gene:ENSG00000198959 transcript:ENST00000536701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNP
KFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDIL
RRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFG
EIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPTPQEKSEGTYCCGPVPVRAIKE
GDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSLIVGLKISTKSVGRDEREDITH
TYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVGQSMNMGSDFDVFAHITNNTAE
EYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEKSVPLCILYEKYRDCLTESNLI
KVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCT
FTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMGLHKLVVNFESDKLKAVKGFRN
VIIGPA
Download sequence
Identical sequences B4DIT7
ENSP00000444701 NP_001310246.1.87134 NP_001310246.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]