SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000445185 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445185
Domain Number 1 Region: 7-194
Classification Level Classification E-value
Superfamily E set domains 5.32e-76
Family RhoGDI-like 0.0000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445185   Gene: ENSG00000111348   Transcript: ENST00000536592
Sequence length 195
Comment pep:novel chromosome:GRCh37:12:15094979:15103629:-1 gene:ENSG00000111348 transcript:ENST00000536592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAP
NVVVTRLTLVCESAPGPITMDLTDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYV
QHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDH
LSWEWNLSIKKEWTE
Download sequence
Identical sequences H0YGX7
ENSP00000445185 ENSP00000445185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]