SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000445263 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445263
Domain Number 1 Region: 11-158
Classification Level Classification E-value
Superfamily E set domains 2.17e-55
Family RhoGDI-like 0.000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445263   Gene: ENSG00000111348   Transcript: ENST00000545895
Sequence length 158
Comment pep:known chromosome:GRCh37:12:15095586:15104085:-1 gene:ENSG00000111348 transcript:ENST00000545895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVT
DPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIV
SGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTP
Download sequence
Identical sequences F5H3P3
ENSP00000445263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]