SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000445450 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445450
Domain Number 1 Region: 11-88
Classification Level Classification E-value
Superfamily E set domains 1.12e-22
Family RhoGDI-like 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445450   Gene: ENSG00000111348   Transcript: ENST00000542276
Sequence length 88
Comment pep:known chromosome:GRCh37:12:15102736:15114662:-1 gene:ENSG00000111348 transcript:ENST00000542276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVT
DPKAPNVVVTRLTLVCESAPGPITMDLT
Download sequence
Identical sequences A0A2J8QQ34 A0A2J8SQQ2 F5H2R5
ENSP00000445450 ENSP00000445450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]