SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000445460 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445460
Domain Number 1 Region: 365-623
Classification Level Classification E-value
Superfamily NHL repeat 2.49e-47
Family NHL repeat 0.00000872
Further Details:      
 
Domain Number 2 Region: 203-299
Classification Level Classification E-value
Superfamily E set domains 6.61e-25
Family Filamin repeat (rod domain) 0.0015
Further Details:      
 
Domain Number 3 Region: 3-50
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000244
Family B-box zinc-binding domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSP00000445460
Domain Number - Region: 35-127
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0876
Family Apolipoprotein A-I 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445460   Gene: ENSG00000110171   Transcript: ENST00000536344
Sequence length 625
Comment pep:known chromosome:GRCh37:11:6469847:6495090:-1 gene:ENSG00000110171 transcript:ENST00000536344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTMEFYCEACETAMCGECRAGEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAA
IALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQSQLD
TLRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELV
LEVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDKDGRLVRTGS
AELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRAL
RPGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSR
GREKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGV
AVDTNGDIIVADYDNRWVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCV
FTFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKF
GSHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEPLYGPQGL
ALTSDGHVVVADAGNHCFKAYRYLQ
Download sequence
Identical sequences H2R2V6
NP_001234936.1.87134 NP_001234936.1.92137 XP_008970703.1.60992 XP_011518147.1.92137 XP_016775758.1.37143 XP_016872588.1.92137 ENSP00000445460 ENSP00000445460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]